Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNEINYLTMAMSLIALAMSFLTFQCNLLIVGMCYGAALVLIIIYIILKINRKTRNKDSNKC 4C48 Chain:C ((1-46)) MLELLKSLVFAVIMVPVVMA--------IILGLIYGLGEVFNIF-------SGVGKKDQPG-

General information: TITO was launched using: RESULT: Template: 4C48.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 10 -1491 -149.05 -32.40 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -149.05 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.010

(partial model without unconserved sides chains): PDB file : Tito_4C48.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4C48-query.scw PDB file : Tito_Scwrl_4C48.pdb: