Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MKLEQKIIDLLCE------IPDNVDYTDVAEDLDLEDIS----EIRIKQLRELLTNSDIYTISSC-----------
1RP3 Chain:B ((2-88))VNRIELSRLIGLLLETSGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGE-YEVSDEKVVKGLIEFFT


General information:
TITO was launched using:
RESULT:

Template: 1RP3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 74 9358 126.45 173.29
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain B : 0.69

3D Compatibility (PKB) : 126.45
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.69
QMean score : 0.369

(partial model without unconserved sides chains):
PDB file : Tito_1RP3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1RP3-query.scw
PDB file : Tito_Scwrl_1RP3.pdb: