Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGFGFVEMPNPHEAIKAIKGLNTLKVKGYGIRVKAAEE 4ED5 Chain:B ((5-79)) --LIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYA--

General information: TITO was launched using: RESULT: Template: 4ED5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 300 -50103 -167.01 -668.03 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain B : 0.84 3D Compatibility (PKB) : -167.01 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.683

(partial model without unconserved sides chains): PDB file : Tito_4ED5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ED5-query.scw PDB file : Tito_Scwrl_4ED5.pdb: