Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSNHDLIHSTAIIDPSAVIASDVQIGPYCIIGPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVGEVCQDLKYKGEETWLEIGNNNLIREHCSLHRGTVQDNALTKIGSHNLLMVNTHIAHDCIVGDHNIFANNVGVAGHVHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIEGMRRKGWSKNTIQGLREAYKLIFKSGLTSVQAIDQIKSEILPSVPEAQLLIDSLEQSERGIVR
5JXX Chain:C ((3-257))------IHPTAIIDKSAMIADSAIIGPYCIVGKNSQIGAHTVLRSHVIIGENTKIGVHNDIYQFASIGENPQDLKYAGEQTYLEIGDHNRIREACTIHRGTVQDRGITRIGNQNLLMVNVHIAHDCVVGDDNVLANNVGVAGHAHIGNHVIIGGQSGVHQFCRIDDYSMVGGASLIVKDVAAYVMASGNPAKAHGLNKEGMRRKGWSKDTIKALDEAYRLVFRSGLLRDEALDEL-TKLVEKEPKIQLLIDSINNSKRGLVR


General information:
TITO was launched using:
RESULT:

Template: 5JXX.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 1518 -189680 -124.95 -743.84
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain C : 0.91

3D Compatibility (PKB) : -124.95
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.91
QMean score : 0.612

(partial model without unconserved sides chains):
PDB file : Tito_5JXX.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5JXX-query.scw
PDB file : Tito_Scwrl_5JXX.pdb: