Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARNADYIDIAGFTIAPQTLLPYGHLYNASLAGNQLNSAHGFAGPILAAPIWLINKPERFFAIAPYLYVPIGTYHSDEALNIDENRWKFDLQLGVFNNVAMIFLPKSRPMLFDMVHMMILLE 4O66 Chain:D ((33-56)) --------------------------------------------------------------IAVFKSLPSRHYDSF------TKTWDFSMS------------------------------

General information: TITO was launched using: RESULT: Template: 4O66.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 39 -3218 -82.50 -134.06 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain D : 0.48 3D Compatibility (PKB) : -82.50 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.463

(partial model without unconserved sides chains): PDB file : Tito_4O66.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4O66-query.scw PDB file : Tito_Scwrl_4O66.pdb: