Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKKKVGDSVKITYYEGSKEKTTTVELTIDQSALKQNQNSEN 3QO6 Chain:C ((307-331)) ---CKVGDEVTVEVLRGDHKEKISVTLE--------------

General information: TITO was launched using: RESULT: Template: 3QO6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 42 -1741 -41.44 -69.62 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain C : 0.76 3D Compatibility (PKB) : -41.44 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.738

(partial model without unconserved sides chains): PDB file : Tito_3QO6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QO6-query.scw PDB file : Tito_Scwrl_3QO6.pdb: