Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTYVRVGKKWNYACFILDLFNREILGYSCGEHKDAVLVKKHLAVSNNL 3A1Q Chain:C ((76-120)) ---GPLGSEEEQFALALKMSEQEAREVNNQEEKEEELLRKAIAESLNS

General information: TITO was launched using: RESULT: Template: 3A1Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 8 -347 -43.38 -7.71 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain C : 0.68 3D Compatibility (PKB) : -43.38 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.240

(partial model without unconserved sides chains): PDB file : Tito_3A1Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3A1Q-query.scw PDB file : Tito_Scwrl_3A1Q.pdb: