Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQEFSYEIVEEIAILSENNKGWRKELNLVSWNGRPPKFDLRDWAPDHEKMGKGLTLTNEEFEQLQKAIENM 4X3S Chain:B ((27-63)) ----------------------------LVKWKGWPPKYST--WEPEEHILDPRLVMAYEEKEERDR-----

General information: TITO was launched using: RESULT: Template: 4X3S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 37 -2118 -57.23 -57.23 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -57.23 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.340

(partial model without unconserved sides chains): PDB file : Tito_4X3S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4X3S-query.scw PDB file : Tito_Scwrl_4X3S.pdb: