Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNKE-MSQTIKVQKMIDDLTHGIDSQADKIIKELQGQKVKDAKMLLKTIN------------FEMNPTKRKLADVLEEKLASAINEQELLFETDTFNS-------------------------------------------------------
2BBD Chain:A ((1-323))GEIYTETLQQTYAWTAGTNIPIKIPRNNFIRKIRVQLIGSISNSGTAAVTLPSAPFPYNLVQTFNLSYEGSKTLYSVSGTGLGILMYYTTKGQNPAYPAPGTSVPASGSVNLNVMWEFDLARFPATMVQNIILSILTGQAPSGVSINASFYITITYERVTAQEILSEGGLGADGEMPLATV-LPKVIEIPTFNVPASSAPIHVAYLQPGQIYKRQLVYVINSTSGINNTDPTEYELKIVRGVPTDKIKVSWAALQAENQAEYQVAPYSGASAIIDFRKYFNGDLDLTHAPSDSIEYDLALQNQDNVYSLYVSYVLPYYDQLAAL


General information:
TITO was launched using:
RESULT:

Template: 2BBD.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 172 13315 77.41 158.51
target 2D structure prediction score : 0.26
Monomeric hydrophicity matching model chain A : 0.50

3D Compatibility (PKB) : 77.41
2D Compatibility (Sec. Struct. Predict.) : 0.26
1D Compatibility (Hydrophobicity) : 0.50
QMean score : 0.185

(partial model without unconserved sides chains):
PDB file : Tito_2BBD.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2BBD-query.scw
PDB file : Tito_Scwrl_2BBD.pdb: