Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGIISREDAEALLENMTEGAFLVRVSEKIWGYTLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLVDFH 5AUL Chain:A ((13-87)) WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAE-PYNLYSSLKELVLHY

General information: TITO was launched using: RESULT: Template: 5AUL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 283 -43056 -152.14 -574.08 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -152.14 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.549

(partial model without unconserved sides chains): PDB file : Tito_5AUL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AUL-query.scw PDB file : Tito_Scwrl_5AUL.pdb: