Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------FVQCNHHLLYNGRHWGTIRKKAGWAVRFYEEKPGQPKRLVAICKNASPVHCNYLKCTN-------LAAGFSAGTSTDVLSSGTVGSIGNDPQAQRQ----------------------------------------------------------------------------------------------------------------------------------------------
2JFV Chain:A ((19-288))MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQ--GIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKT--QNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL


General information:
TITO was launched using:
RESULT:

Template: 2JFV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 330 -4091 -12.40 -48.12
target 2D structure prediction score : 0.36
Monomeric hydrophicity matching model chain A : 0.53

3D Compatibility (PKB) : -12.40
2D Compatibility (Sec. Struct. Predict.) : 0.36
1D Compatibility (Hydrophobicity) : 0.53
QMean score : 0.060

(partial model without unconserved sides chains):
PDB file : Tito_2JFV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2JFV-query.scw
PDB file : Tito_Scwrl_2JFV.pdb: