Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTIRFEEKVSTENAQFVCQWSNSLGKSFQEQWMGPRIPFLLTLQALEGVFSIFDEQEFVGFIQKIRLEDSNLHIGRFFINPQKQEQGLGSQALRKFVSLAFENEDIDSISLNVFEANQRAQNLYQKEGFEIVQMVEAPVRKYSILKLE 4PV6 Chain:F ((62-137)) ----------------------------------------------------------VGFIVGSKYSRTEARILLFAVDERFRRMGVGSALMDAFLSLCRE-QNMLSVRLEVRTDNDEAIRFYKKYGFVITAML-------------

General information: TITO was launched using: RESULT: Template: 4PV6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 233 -41938 -179.99 -551.82 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain F : 0.64 3D Compatibility (PKB) : -179.99 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.634

(partial model without unconserved sides chains): PDB file : Tito_4PV6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4PV6-query.scw PDB file : Tito_Scwrl_4PV6.pdb: