Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRADIHPKYEKLVATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGRIDKFKQRFAGMSRSIKR 3J6B Chain:V ((38-83)) -RPAIYHQF-NVKMELSDGSVVIRRSQYPKGEIRLIQDQRNNPLWNPS--------------------------

General information: TITO was launched using: RESULT: Template: 3J6B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 102 -5072 -49.73 -110.26 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain V : 0.66 3D Compatibility (PKB) : -49.73 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.509

(partial model without unconserved sides chains): PDB file : Tito_3J6B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J6B-query.scw PDB file : Tito_Scwrl_3J6B.pdb: