Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------MGLNMPEPTSTTAATTTSLAAVSL--------LPFINGNALLGAVLGAAFVAYLE-----KDLSAKQRIVFMLLCVGFG---YLLGPEITSRTQYI--SSDATASMVAAIFAIYILIKLLDWVKNSTLAQLWKTFRGGGNS--
4FFE Chain:X ((0-149))GHKLAFNFNLEINGSDTHSTVDVYLDDSQIITFDGKDIRPTIPFMIGDEIFLPFYKNVFSEFFSLFRRVPTSTPYEDLTYFYECDYTDNKSTFDQFYLYNGEEYTVKTQEATNKNMWLTTSEFRLKKWFD--GEDCIMHLRSLVRKMEDSKR


General information:
TITO was launched using:
RESULT:

Template: 4FFE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 461 9805 21.27 81.03
target 2D structure prediction score : 0.48
Monomeric hydrophicity matching model chain X : 0.67

3D Compatibility (PKB) : 21.27
2D Compatibility (Sec. Struct. Predict.) : 0.48
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.056

(partial model without unconserved sides chains):
PDB file : Tito_4FFE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4FFE-query.scw
PDB file : Tito_Scwrl_4FFE.pdb: