Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAMTFYNKDIQYRVTLDTDLNLFVVFDKENTNHVATGVTIEQAVQELKKSA 1XNL Chain:A ((1-28)) -----------------------GPTARIFASILAPGVAAAQALREIERLA

General information: TITO was launched using: RESULT: Template: 1XNL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 27 -1475 -54.61 -52.66 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -54.61 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.508

(partial model without unconserved sides chains): PDB file : Tito_1XNL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1XNL-query.scw PDB file : Tito_Scwrl_1XNL.pdb: