Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---EWCTVTVFYQGRTSG-----YPLPTAKKVGIVQSFPGEGKGYADYQYILDEN-----CDWKEHGRPW---LTGMRLETVPFVAKQKYE------ 1URR Chain:A ((6-102)) VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH

General information: TITO was launched using: RESULT: Template: 1URR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 310 6899 22.25 91.99 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 22.25 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.372

(partial model without unconserved sides chains): PDB file : Tito_1URR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1URR-query.scw PDB file : Tito_Scwrl_1URR.pdb: