Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------ICDIVIRFE-----GAVVET-----GTMGPSTAKTFNLITDQISITVDHNCNITHWTQV-----------EKFT--VSSTLRNPPAAAAARR------------------------------------------------------------------------------------------------------------------------------- 1JI6 Chain:A ((64-290)) DAVGTGISVVGQILGVVGVPFAGALTSFYQSFLNTIWPSDADPWKAFMAQVEVLIDKKIEEYAKSKALAELQGLQNNFEDYVNALNSWKKTPLSLRSKRSQDRIRELFSQAESHFRNSMPSFAVSKFEVLFLPTYAQAANTHLLLLKDAQVFGEEWGYSSEDVAEFYHRQLKLTQQYTDHCVNWYNVGLNGLRGSTYDAWVKFNRFRREMTLTVLDLIVLFPFYDIR

General information: TITO was launched using: RESULT: Template: 1JI6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 122 -6304 -51.67 -91.36 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -51.67 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.108

(partial model without unconserved sides chains): PDB file : Tito_1JI6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JI6-query.scw PDB file : Tito_Scwrl_1JI6.pdb: