Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 1FYR Chain:D ((13-88)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1FYR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 216 -20928 -96.89 -275.37 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain D : 1.00 3D Compatibility (PKB) : -96.89 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.667

(partial model without unconserved sides chains): PDB file : Tito_1FYR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FYR-query.scw PDB file : Tito_Scwrl_1FYR.pdb: