Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVT-TQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHY 1X27 Chain:B ((68-150)) WFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHY

General information: TITO was launched using: RESULT: Template: 1X27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 303 -10243 -33.81 -124.91 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain B : 0.93 3D Compatibility (PKB) : -33.81 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.93 QMean score : 0.693

(partial model without unconserved sides chains): PDB file : Tito_1X27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X27-query.scw PDB file : Tito_Scwrl_1X27.pdb: