Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFY 3IN7 Chain:C ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3IN7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 278 -42272 -152.06 -556.20 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain C : 0.91 3D Compatibility (PKB) : -152.06 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.91 QMean score : 0.641

(partial model without unconserved sides chains): PDB file : Tito_3IN7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IN7-query.scw PDB file : Tito_Scwrl_3IN7.pdb: