Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAM-CGDYYIGGRRFSSLSDLIGYY 2HUW Chain:B ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLS-VKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 2HUW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 269 -22665 -84.26 -302.20 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain B : 0.77 3D Compatibility (PKB) : -84.26 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.663

(partial model without unconserved sides chains): PDB file : Tito_2HUW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HUW-query.scw PDB file : Tito_Scwrl_2HUW.pdb: