Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLS-DQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHF 5EHP Chain:A ((113-213)) WFHGHLSG-EAEKLLTEKGKHGSFLVRES-SHPGDFVLSVRTG---------S-KVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 5EHP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -13734 -48.70 -188.13 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -48.70 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.757

(partial model without unconserved sides chains): PDB file : Tito_5EHP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EHP-query.scw PDB file : Tito_Scwrl_5EHP.pdb: