Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAK-SSTDLKVN--DQVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV 5WXM Chain:A ((85-138)) RRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVD-------------------------------------

General information: TITO was launched using: RESULT: Template: 5WXM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 188 -24839 -132.12 -487.04 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -132.12 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.622

(partial model without unconserved sides chains): PDB file : Tito_5WXM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5WXM-query.scw PDB file : Tito_Scwrl_5WXM.pdb: