Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEMSFIAQDFDKLNIITVLESRTQAIIRNP----MNTRLSSATGSSFNKIVRN------------------------------------------- 4A54 Chain:A ((-1-94)) -GMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMD

General information: TITO was launched using: RESULT: Template: 4A54.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 116 2722 23.46 56.70 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 23.46 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.067

(partial model without unconserved sides chains): PDB file : Tito_4A54.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4A54-query.scw PDB file : Tito_Scwrl_4A54.pdb: