Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------MELAETSIVKKNHQIPCIINQKIAQKLI-----EKTSMTDI-DHQLSISTSTVIR--KINNFHFEHDFSRLPEIMS 4FH0 Chain:A ((5-99)) QTYCDRLVQDTPMLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLMSHLQRSGERDCQEFYRALYIHAQPLHSRLPSR--

General information: TITO was launched using: RESULT: Template: 4FH0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 166 5984 36.05 90.66 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 36.05 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.362

(partial model without unconserved sides chains): PDB file : Tito_4FH0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4FH0-query.scw PDB file : Tito_Scwrl_4FH0.pdb: