Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLEQTARLKEVKKQIARIKTVQSEAK 5DM6 Chain:V ((1-61)) -------MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELA

General information: TITO was launched using: RESULT: Template: 5DM6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 120 -3505 -29.21 -57.46 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain V : 0.82 3D Compatibility (PKB) : -29.21 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.702

(partial model without unconserved sides chains): PDB file : Tito_5DM6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DM6-query.scw PDB file : Tito_Scwrl_5DM6.pdb: