Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQFIQIPWSHINQIGANVTGRKISRHFEVFTD-KGKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKFKNLFAKK 5EJY Chain:A ((426-496)) ------------------------NFVLALNVNGINIYDPATSKMLESVKYSNQSQQNLKSDD---KS-VSIILENKSTLQAFTGDVQKLVSLIKEYSL-------------------------

General information: TITO was launched using: RESULT: Template: 5EJY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 229 -22942 -100.18 -327.74 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -100.18 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.655

(partial model without unconserved sides chains): PDB file : Tito_5EJY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EJY-query.scw PDB file : Tito_Scwrl_5EJY.pdb: