Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MDKKQNLTSFQELTTTELNQITGGGW--------WEELLHETILSKFKITKALELPIQL---------------------------------------- 1V4R Chain:A ((1-100)) MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGE

General information: TITO was launched using: RESULT: Template: 1V4R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 161 8498 52.78 166.63 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 52.78 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.274

(partial model without unconserved sides chains): PDB file : Tito_1V4R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1V4R-query.scw PDB file : Tito_Scwrl_1V4R.pdb: