Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGM------NMMHGKMIVE 4W9Z Chain:A ((41-121)) ---------------------------------------------RLLGVDNEMVVPVNKVIRVQVTGAD---VIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELCGKDHAFMPIAIRVV

General information: TITO was launched using: RESULT: Template: 4W9Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 257 -37257 -144.97 -496.75 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -144.97 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.482

(partial model without unconserved sides chains): PDB file : Tito_4W9Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4W9Z-query.scw PDB file : Tito_Scwrl_4W9Z.pdb: