Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVRSQIFDQILERYPKDNFLQEQIEILTSIDNRE 1OR7 Chain:B ((130-186)) -----------IVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQ------------------------------------------

General information: TITO was launched using: RESULT: Template: 1OR7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 181 -28624 -158.14 -502.18 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -158.14 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.751

(partial model without unconserved sides chains): PDB file : Tito_1OR7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OR7-query.scw PDB file : Tito_Scwrl_1OR7.pdb: