Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --MPQVKLKEGEPVDVAIRRFKRSCEKAGVL--ADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY----- 4OU6 Chain:A ((1-76)) VPMGKFAMYPDWQPD---ADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLAR-SLQIGRASNGGLP

General information: TITO was launched using: RESULT: Template: 4OU6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 16241 78.84 242.40 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 78.84 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.558

(partial model without unconserved sides chains): PDB file : Tito_4OU6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OU6-query.scw PDB file : Tito_Scwrl_4OU6.pdb: