Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIERQKTALHLANQRLEALQKQVSLLEEALKNKK
5J9T Chain:D ((1-119))MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEQKESQIHKFIRQQGSIPKHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAP


General information:
TITO was launched using:
RESULT:

Template: 5J9T.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 74 7510 101.49 100.13
target 2D structure prediction score : 0.89
Monomeric hydrophicity matching model chain D : 0.64

3D Compatibility (PKB) : 101.49
2D Compatibility (Sec. Struct. Predict.) : 0.89
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.546

(partial model without unconserved sides chains):
PDB file : Tito_5J9T.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5J9T-query.scw
PDB file : Tito_Scwrl_5J9T.pdb: