Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSAVNFNMRLEAELKEQVTPILEDYGLTMPQAFKLFLNQIVKTKAIPLSFDYARETALTPKAAAKLLQSLKEIENGEYTEYETVEEAIKAMSEEAHG 2V6Z Chain:M ((25-99)) MA--------PERLRSRALSAFKLRGLLLRGEAIKYLTEALQSIS-----ELELEDKLEKIINAVEKQPL----SSNMIERSVVEAAVQESS-----

General information: TITO was launched using: RESULT: Template: 2V6Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 270 -29504 -109.27 -393.38 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain M : 0.64 3D Compatibility (PKB) : -109.27 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.297

(partial model without unconserved sides chains): PDB file : Tito_2V6Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2V6Z-query.scw PDB file : Tito_Scwrl_2V6Z.pdb: