Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKIKSYTSIWAVEKVIYAINDFQLPFPVTFNQMAWFVLSLLFVIVFAHVPPLSMIEEVFLKYLGIPVAVTWFMSQKTFDGKKPLGFLRSFISYHLRFKVTFAGKKVKEQKKRWDEPSTLVRSVNYVSD 2KVT Chain:A ((1-71)) ----------------------------------------------MPTKPPYPREAYIVTIEKGKP-GQTVTWYQLRADHPKP----DSLISEHPT------AQEAMDAKKRYEDPDKELEHHHHHH-

General information: TITO was launched using: RESULT: Template: 2KVT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 3268 18.89 46.02 target 2D structure prediction score : 0.34 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : 18.89 2D Compatibility (Sec. Struct. Predict.) : 0.34 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.141

(partial model without unconserved sides chains): PDB file : Tito_2KVT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KVT-query.scw PDB file : Tito_Scwrl_2KVT.pdb: