Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 2DLY Chain:A ((18-95)) WFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGDFSLSVLDEGVVKHYRIRRLDEGGFFLTRRKVFSTLNEFVNYY

General information: TITO was launched using: RESULT: Template: 2DLY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 289 -47217 -163.38 -605.34 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.97 3D Compatibility (PKB) : -163.38 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.97 QMean score : 0.595

(partial model without unconserved sides chains): PDB file : Tito_2DLY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DLY-query.scw PDB file : Tito_Scwrl_2DLY.pdb: