Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------YECYVSLKINGIEHYKPEGRMEFPGATTVYDIGGYGTVVIVLGDTCEPIYKTELKLPQAFDFSSRIFK-KRKQSEGQPSGREEVKHQRIEAQEWKPGNV--------------------------------------
3R0R Chain:A ((33-226))HPFTNGIFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPL


General information:
TITO was launched using:
RESULT:

Template: 3R0R.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 157 7511 47.84 76.64
target 2D structure prediction score : 0.47
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : 47.84
2D Compatibility (Sec. Struct. Predict.) : 0.47
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.048

(partial model without unconserved sides chains):
PDB file : Tito_3R0R.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3R0R-query.scw
PDB file : Tito_Scwrl_3R0R.pdb: