Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEGKQMNSMEKVNQFRDERNWRQFHNEKDLAISISLEASELLELFQWKTPEEVK-ETQLERIKEELADVLIYSYMMADNLHLDLDEIIEEKLIKNNLKYPVEKSAGVRKKYTEL 1OGK Chain:D ((23-116)) ----------DGLNIFMDP-DWRQIRHVDDWALAITMESAELIDSYPWKWWKNVKAQTDMHNVRIEIADILHFS-----------------------------------------

General information: TITO was launched using: RESULT: Template: 1OGK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 104 -1415 -13.60 -22.81 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain D : 0.73 3D Compatibility (PKB) : -13.60 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.382

(partial model without unconserved sides chains): PDB file : Tito_1OGK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OGK-query.scw PDB file : Tito_Scwrl_1OGK.pdb: