Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHY
1NZV Chain:B ((4-86))WYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYY


General information:
TITO was launched using:
RESULT:

Template: 1NZV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 307 -40681 -132.51 -490.13
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain B : 0.92

3D Compatibility (PKB) : -132.51
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.92
QMean score : 0.729

(partial model without unconserved sides chains):
PDB file : Tito_1NZV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1NZV-query.scw
PDB file : Tito_Scwrl_1NZV.pdb: