Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH 1L9U Chain:H ((92-175)) ARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEY--KRRFKFSTYATWWIRQAINRAIADQART----------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1L9U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 204 -28311 -138.78 -377.47 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain H : 0.63 3D Compatibility (PKB) : -138.78 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.63 QMean score : ?

(partial model without unconserved sides chains): PDB file : Tito_1L9U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1L9U-query.scw PDB file : Tito_Scwrl_1L9U.pdb: