Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRSLTGVSNPTTDSARLVLAEANKAFADDSLTEQGLRD---ILQTVKD---AIASLESIKESQSATKD------GGQTAGKETAGEDESANQTQEISQGIK----
2MXY Chain:A ((1-105))ASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYG


General information:
TITO was launched using:
RESULT:

Template: 2MXY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 440 25409 57.75 285.49
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain A : 0.69

3D Compatibility (PKB) : 57.75
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.69
QMean score : 0.229

(partial model without unconserved sides chains):
PDB file : Tito_2MXY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2MXY-query.scw
PDB file : Tito_Scwrl_2MXY.pdb: