Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEQAFKEKHYENTILHSDQGWQYQHDSYHRFLESKGIQASMSRKGNSQDNGRMESFFGILKSEMFYGYEQTFKSLNQLE 1BL3 Chain:C ((62-113)) -------------KTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKII---------------

General information: TITO was launched using: RESULT: Template: 1BL3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 105 -253 -2.40 -4.86 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -2.40 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.445

(partial model without unconserved sides chains): PDB file : Tito_1BL3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BL3-query.scw PDB file : Tito_Scwrl_1BL3.pdb: