Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKVLLGFMGAGKSTIAR----GLDPNYLDMDALIEKRLGMSIANFFAEKGEAAFRQVESEVL-ADLLQTDQVVSTGGGVVISQRNRDLLKTNTDNIYLKADFETLYLRIVADKDNQRPLFLNNSK-EELVAIFQERQAWYEEVASRVLDVTKLSPEEIIEELR
4BQS Chain:C ((6-162))---VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHT-VVYLEISAAEGVRRT--GGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHI-


General information:
TITO was launched using:
RESULT:

Template: 4BQS.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 681 27262 40.03 180.54
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain C : 0.78

3D Compatibility (PKB) : 40.03
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.554

(partial model without unconserved sides chains):
PDB file : Tito_4BQS.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4BQS-query.scw
PDB file : Tito_Scwrl_4BQS.pdb: