Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSWTFDNKKPIYLQIMEKIKLQIVSHTLEPNQQLPTVRELASEAGVNPNTIQRALSDLEREGFVYSKRTTGRFVTKDKELIAQSRKQLSEEELEHFVSSMTHFGYEKEELPGVVSDYIKGV 4WWC Chain:B ((13-91)) ---------PIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVSKPK-------------------------------------------

General information: TITO was launched using: RESULT: Template: 4WWC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 233 -28744 -123.36 -416.57 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -123.36 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.844

(partial model without unconserved sides chains): PDB file : Tito_4WWC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WWC-query.scw PDB file : Tito_Scwrl_4WWC.pdb: