Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKNFRVKREKDFKAIFKEGTSFANRKFVVYQLENQKNHFRVGLSVSKKLGNAVTRNQIKRRIRHIIQNAKGSLVEDVDFVVIARKGVETLGYAEMEKNLLHVLKLSKIYREGNGSEKETKVD 5F6C Chain:A ((138-196)) ------------------------------------------AGGISRRIEGD-DRTELKEALASLE------LPEGMGL--IVRTAGVGKSAEALQWDLSFRLKHWEAI-------------

General information: TITO was launched using: RESULT: Template: 5F6C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 149 -18459 -123.88 -312.86 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -123.88 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.538

(partial model without unconserved sides chains): PDB file : Tito_5F6C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5F6C-query.scw PDB file : Tito_Scwrl_5F6C.pdb: