Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGAMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK----- 1E68 Chain:A ((1-70)) MAKEF---------------GIPAAVAGTVLNVVEAGGWVTTIVSILTAVG--------------------SGGLSLLAAA----GRESIKAYLKKEIKKKGKRAVIAW

General information: TITO was launched using: RESULT: Template: 1E68.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 223 -51503 -230.96 -792.35 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -230.96 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.350

(partial model without unconserved sides chains): PDB file : Tito_1E68.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1E68-query.scw PDB file : Tito_Scwrl_1E68.pdb: