Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNDKELTFKEGHDILKQNAELL--ESQESPDIDNLMKIVEESIGAYKACKSRIEAVQQALDETFKE 1H7C Chain:A ((24-82)) -----VMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRIL--

General information: TITO was launched using: RESULT: Template: 1H7C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 84 8164 97.18 143.22 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : 97.18 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.643

(partial model without unconserved sides chains): PDB file : Tito_1H7C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H7C-query.scw PDB file : Tito_Scwrl_1H7C.pdb: