Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRIILLGPPGAGKGTQAQLICKRYNIPQISTGDMLRAAIREGTELGLKAKSVMESGGLVSDELIIGLVKERIAQPDCVNGCIFDGFPRTIPQAEALEKEGISIDHVIEIDVPDEEIVKRLSGRRQHPASGRVYHVVYNPPKVEGKDDETGEDLVQRPDDQEETIRKRLASYHTETEQLVGFYQGRAASGENAPTYDKLDGLRTIEDVQKDLFNILDK
3HPR Chain:B ((1-213))MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDGTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNT--KYAKVDGTKPVAEVRADLEKIL--


General information:
TITO was launched using:
RESULT:

Template: 3HPR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1037 -70768 -68.24 -332.24
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain B : 0.89

3D Compatibility (PKB) : -68.24
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.89
QMean score : 0.565

(partial model without unconserved sides chains):
PDB file : Tito_3HPR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3HPR-query.scw
PDB file : Tito_Scwrl_3HPR.pdb: