Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------------------------------------------------------------------------------------------------------------MIEVTDTAVTSFDDAAEGIEQSRTDGKGLNESHAKGCKN------------------------------------------------------------------------------
3HL1 Chain:A ((3-317))PPVWTLPRLYQHFQGAIDLELWTIPYYLTVLYSIKDPTTVPYRLIQAAVYQEMLHAQLVSNIANAYGYSPTLSAPEYVGTAVPHIDFDLDTPNPTSIFTPYSAELGPLDLTRVNTMCLIEYPEWRTQREPDLADDVTDYGSIGEFYDALRVGMEQLRGHVRGNQKQMDENSPPLTVTESGDAGFLQALTLVDIIVDQGEGQAWPHFQRFDFIRRMPNWPGVYTGVTDPPAGSPGAEAQARLIADFAGFLDILNGMFSGGGAPPAFGVQMAKLGGDILSCWKLGAVPRYS


General information:
TITO was launched using:
RESULT:

Template: 3HL1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 10 -1582 -158.20 -40.56
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.49

3D Compatibility (PKB) : -158.20
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.49
QMean score : 0.195

(partial model without unconserved sides chains):
PDB file : Tito_3HL1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3HL1-query.scw
PDB file : Tito_Scwrl_3HL1.pdb: