Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMISMKVVFHIDEL--E--KWSETGKNVKNLIKASPETTIVVSVNGIAITGYLDSAN------------AEFLDLQGV-VFHACANAMRANHISESSLPEQV------------IVVPAGVLDLVELQSQGYAYIKP
2HYB Chain:K ((3205-3335))--VKKFMYLNRKAPYGTIYAWEALEVVLIGAAF--DQDVCVLFLDDGVYQLTRGQDTKGIGMKNFSPTYRTLGDYEVRRIYVDRDSLEARGLTQDDLVEIAFEDMETEEEFDNIVEVIDSARVSELMNESDAVFS-


General information:
TITO was launched using:
RESULT:

Template: 2HYB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 394 9695 24.61 95.05
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain K : 0.61

3D Compatibility (PKB) : 24.61
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.538

(partial model without unconserved sides chains):
PDB file : Tito_2HYB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HYB-query.scw
PDB file : Tito_Scwrl_2HYB.pdb: