Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----MKNKFENR--SDTRCGSFLYILYEVFFIPYEK---------ISLKIKKDENKRFSIKRRP--------FIFCLYLCEKRKRAQHIKLLLIVCLL------------- 1UNN Chain:C ((5-115)) HHVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL

General information: TITO was launched using: RESULT: Template: 1UNN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 205 12121 59.12 161.61 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : 59.12 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.407

(partial model without unconserved sides chains): PDB file : Tito_1UNN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UNN-query.scw PDB file : Tito_Scwrl_1UNN.pdb: